General Information

  • ID:  hor006952
  • Uniprot ID:  P14174??3-115)
  • Protein name:  Macrophage migration inhibitory factor
  • Gene name:  IFNT; IFN;
  • Organism:  Homo sapiens
  • Family:  MIF family
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0009986 cell surface; GO:0005737 cytoplasm; GO:0005829 cytosol; GO:0070062 extracellular exosome; GO:0005576 extracellular region; GO:0005615 extracellular space; GO:1904813 ficolin-1-rich granule lumen; GO:0005654 nucleoplasm; GO:0005886 plasma membrane; GO:0034774 secretory granule lumen; GO:0031982 vesicle
  • GO BP:  GO:0005126 cytokine receptor binding; GO:0005125 cytokine activity; GO:0042802 identical protein binding; GO:0050178 phenylpyruvate tautomerase activity; GO:0002020 protease binding; GO:0042056 chemoattractant activity; GO:0004167 dopachrome isomerase activity
  • GO CC:  GO:0030330 DNA damage response signal transduction by p53 class mediator; GO:0090398 cellular senescence; GO:0051248 negative regulation of protein metabolic process; GO:0090238 positive regulation of arachidonic acid secretion; GO:0030890 positive regulation of B cell proliferation; GO:0008284 positive regulation of cell population proliferation; GO:0010760 negative regulation of macrophage chemotaxis; GO:1902166 negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator; GO:0010629 negative regulation of gene expression; GO:0006954 inflammatory response; GO:0043518 negative regulation of DNA damage response signal transduction by p53 class mediator; GO:0007166 cell surface receptor signaling pathway; GO:2000773 negative regulation of cellular senescence; GO:0030336 negative regulation of cell migration; GO:0043066 negative regulation of apoptotic process; GO:0045087 innate immune response; GO:0033033 negative regulation of myeloid cel

Sequence Information

  • Sequence:  MFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
  • Length:  113
  • Propeptide:  MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA